PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi09g05300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 151aa    MW: 16450.6 Da    PI: 10.0444
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi09g05300.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP79.45.2e-2586134149
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                      +Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsr 
  Vradi09g05300.1  86 RCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRL 134
                      6**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.4E-2680134IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.82884150IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.55E-2485137IPR004333Transcription factor, SBP-box
PfamPF031109.7E-1987134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MLSLDPLPHV NAANCGPGPG PGPGGLLLVP KSEDVGRPMD FVGSRIGLNL GGRTYFSSSE  60
DDFVSRLYRR SRPAESGSAA SSNSPRCQAE GCNADLSQAK HYHRRHKVCE FHSKAATVIA  120
AGLTQRFCQQ CSRLWWRLSL PHRRKININH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-1877134158squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014515969.13e-93PREDICTED: squamosa promoter-binding-like protein 8
RefseqXP_014515970.13e-93PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL35e-55SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A0L9VUR31e-92A0A0L9VUR3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SV822e-91A0A0S3SV82_PHAAN; Uncharacterized protein
STRINGGLYMA03G27180.18e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68013348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.27e-57squamosa promoter binding protein-like 8